DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG4793

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:363 Identity:106/363 - (29%)
Similarity:157/363 - (43%) Gaps:67/363 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CIHLEDCKYLYGLLTTTPLRDTDRLYLSRSQC--GYTNGKVLICCPDRYRESSSETTPPPKPNVT 109
            |:....|:  .|..|..|:.|...|......|  |.|      |||        :|.....|...
  Fly    29 CVQRNRCR--IGTETGRPIIDFRGLNNGNQGCESGQT------CCP--------KTEILQYPVQA 77

  Fly   110 SNSLLPLPGQCGNILSNRIYGGMK-------TKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRY 167
            .|.  |||.:||::  |||..|..       .:..|.|||..:..::|:...|   |||||:...
  Fly    78 DNQ--PLPTECGHV--NRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLG---GGSLITRDV 135

  Fly   168 VITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIP 232
            |:|:|    .|.|....:...||.||||..:..:           ...|.||.:.:.:.|.:.  
  Fly   136 VLTSS----TKTLEVPEKYLIVRAGEWDFESITE-----------ERAHEDVAIRKIVRHTNL-- 183

  Fly   233 ASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKA 297
            :.:|..|:.|||.||:.::....:..||||..    :..|......|:||||...|..|.:.:..
  Fly   184 SVENGANNAALLFLARPLKLDHHIGLICLPPP----NRNFIHNRCIVSGWGKKTALDNSYMNILK 244

  Fly   298 AVEGFRMDE--CQNVYS---SQDILLEDTQMCAGGKEGVDSCRGDSGGPL---IGLDTNKVNTYY 354
            .:|...:|.  ||....   .:|.:|:::.:||||:.|.|:|:||.|.||   :..|.|:    |
  Fly   245 KIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNR----Y 305

  Fly   355 FLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIES 392
            .|.|:|:|| ..|| ...|..||.|.:...||.|.|::
  Fly   306 ELLGIVNFG-FGCG-GPLPAAYTDVSQIRSWIDNCIQA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 10/43 (23%)
Tryp_SPc 127..386 CDD:214473 80/273 (29%)
Tryp_SPc 128..389 CDD:238113 81/275 (29%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 79/261 (30%)
Tryp_SPc 105..335 CDD:214473 77/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.