DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG18478

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:323 Identity:81/323 - (25%)
Similarity:122/323 - (37%) Gaps:75/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QCGYTNGKVLICCPDRYRESSSETTPPPKPNVTSNSLLPLPGQCGNILSNRIYGGMKTKIDEFPW 141
            :|||.|       ||..:...:.|....||                              .||||
  Fly    30 KCGYGN-------PDAVKVQFNVTEGQAKP------------------------------AEFPW 57

  Fly   142 -MALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVD 205
             :|:|......|      |||||:...|:||:|.:..|    |.....|..|||:..:..:    
  Fly    58 TIAVIHNRSLVG------GGSLITPDIVLTAAHRIFNK----DVEDIVVSAGEWEYGSALE---- 108

  Fly   206 VRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSA 270
                   ..|..:..|.:.:.|..:  ..:...|::|||.|.::...|..:..||||......|:
  Fly   109 -------KYPFEEAFVLKMVIHKSF--NYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSS 164

  Fly   271 TFDGITMDVAGWGKTEQLSASN-------LKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGK 328
            |    ...|||||| .|.|.::       :.|.........|:.:.....|:..|....:||||:
  Fly   165 T----RCIVAGWGK-YQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGE 224

  Fly   329 EGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIE 391
            :..|:|.||.||.|....|.....:..: |:|::| ..|.....|..||.|.::..||...|:
  Fly   225 KDNDACTGDGGGALFCPMTEDPKQFEQI-GIVNWG-VGCKEKNVPATYTDVFEFKPWIVQQIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 4/11 (36%)
Tryp_SPc 127..386 CDD:214473 69/266 (26%)
Tryp_SPc 128..389 CDD:238113 71/268 (26%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 73/292 (25%)
Tryp_SPc 50..280 CDD:214473 71/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.