DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG5390

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:320 Identity:92/320 - (28%)
Similarity:146/320 - (45%) Gaps:61/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ICC--PDRYRESSSETTPPPKPNVTSNSLLPLPGQCG----NILSNRIYGGM--KTKIDEFPWMA 143
            :||  |::.::...|..|..            |..||    |.:..:|.|.:  :.:..|||||.
  Fly   112 LCCDLPNKRKDPIFEFKPDH------------PEGCGYQNPNGVGFKITGAVNQEAEFGEFPWML 164

  Fly   144 LIEYTKSQGKKG-HHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVR 207
            .|  .:.:|... :.|||:||:...|:||:|||:.|. |:.   ..||.|||||.|    :.::|
  Fly   165 AI--LREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ-PSS---IVVRAGEWDTQT----QTEIR 219

  Fly   208 GMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATF 272
                   .|.|..|:..|.|..:...|  ..||:|::.|.......:.::.:|||   |: ...|
  Fly   220 -------RHEDRYVKEIIYHEQFNKGS--LYNDVAVMLLESPFTLQENIQTVCLP---NV-GDKF 271

  Fly   273 DGITMDVAGWGKTE-------QLSASNLKLKAAVEGFRMDECQ-NVYSS---QDILLEDTQMCAG 326
            |.......||||.:       |:....:.:....|    .:|: |:..:   :..:|.|:.:|||
  Fly   272 DFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPE----QQCETNLRETRLGRHFILHDSFICAG 332

  Fly   327 GKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI 386
            |::..|:|:||.|.||:.....:.|.:. .||:|::| ..||....||||..|.|...||
  Fly   333 GEKDKDTCKGDGGSPLVCPIAGQKNRFK-SAGIVAWG-IGCGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 0/1 (0%)
Tryp_SPc 127..386 CDD:214473 81/272 (30%)
Tryp_SPc 128..389 CDD:238113 83/273 (30%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 81/267 (30%)
Tryp_SPc 153..390 CDD:214473 79/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.