DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and prss60.3

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:280 Identity:87/280 - (31%)
Similarity:134/280 - (47%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 CGNI-LSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTD 183
            ||.. |:.||.||:......:||...:...|   ..||.|||||||:.:|:||:||::|.:..|.
Zfish    27 CGQAPLNTRIVGGVNASPGSWPWQVSLHSPK---YGGHFCGGSLISSEWVLTAAHCLSGVSETTL 88

  Fly   184 WRLSGVR----LGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALL 244
            ....|.|    :..::|:.|                     |.::..|..|  .|....||||||
Zfish    89 VVYLGRRTQQGINIYETSRN---------------------VAKSFVHSSY--NSNTNDNDIALL 130

  Fly   245 RLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTE---QLSASNLKLKAAVEGFRMDE 306
            ||:..|.:|:::||:||....::.||   |.:..:.|||..:   .|.|..:..:..:.....|.
Zfish   131 RLSSAVTFTNYIRPVCLAAQNSVYSA---GTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDR 192

  Fly   307 CQNVYSSQDILLEDTQMCAG-GKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLA 370
            |..:..|..:  .:..:||| .:.|.|:|:||||||::    .::.|.:..||:.|:| ..|...
Zfish   193 CNALLGSGTV--TNNMICAGLTQGGKDTCQGDSGGPMV----TRLCTVWVQAGITSWG-YGCADP 250

  Fly   371 GWPGVYTLVGKYVDWIQNTI 390
            ..|||||.|.:|..||.:.|
Zfish   251 NSPGVYTRVSQYQSWISSKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 81/266 (30%)
Tryp_SPc 128..389 CDD:238113 82/268 (31%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 82/268 (31%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.