DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG4259

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:262 Identity:75/262 - (28%)
Similarity:113/262 - (43%) Gaps:67/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 FPWMALIEYTKSQGKKGHHCG-GSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDC 202
            |||  ::.....:.....:.| ||||:...|:||:|.:||   .|.:.|. ||.|||||:|..|.
  Fly    39 FPW--VVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNG---TTKYDLV-VRAGEWDTSTTADQ 97

  Fly   203 EVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLD--- 264
            :            |:|:.|...:.|..:  ...|..|::|||.|....|.|..:..|.|.|.   
  Fly    98 Q------------HVDLEVLNIVSHEQF--NRFNAENNMALLILVSAFEMTANINLIPLYLQEAG 148

  Fly   265 VNLRSATFDGITMDVAGWGKTEQLSASNLK--LKAA-VEGFRMDECQNVYSSQDILLEDTQMCAG 326
            :...|..|:       ||||. .|::::..  ||.. |:...|..|    ||:.:.::  |:|..
  Fly   149 IQKGSCFFN-------GWGKV-YLNSTDYPTVLKTVQVDLLSMGMC----SSRKLPIQ--QICGK 199

  Fly   327 GKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI-QNTI 390
            |.||:| |.||.|.||:                       |.:..:|..|..|| .|:|: |..:
  Fly   200 GLEGID-CSGDGGAPLV-----------------------CRILTYPYKYAQVG-IVNWLSQKPV 239

  Fly   391 ES 392
            |:
  Fly   240 EN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 72/253 (28%)
Tryp_SPc 128..389 CDD:238113 74/257 (29%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 75/262 (29%)
Tryp_SPc 39..256 CDD:214473 75/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.