DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG1304

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:287 Identity:77/287 - (26%)
Similarity:121/287 - (42%) Gaps:71/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCV-----N 176
            ||.    |:.|:.||.....::||....:....|     |.||||::|..||:||:|||     |
  Fly    25 PGS----LNGRVVGGEDAVKNQFPHQVSLRNAGS-----HSCGGSILSRNYVLTAAHCVTNQDSN 80

  Fly   177 GKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDI 241
            |.::|.......:|.|..|..:.        |:.        |.|...|.|.:|    .|.:||:
  Fly    81 GNSVPIAAERFTIRAGSNDRFSG--------GVL--------VQVAEVIVHEEY----GNFLNDV 125

  Fly   242 ALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQ-------LSASNLKLKAAV 299
            |||||...:..:..::||.||     .:.|...:.:.::|||:.:.       |..:.||     
  Fly   126 ALLRLESPLILSASIQPIDLP-----TADTPADVDVIISGWGRIKHQGDLPRYLQYNTLK----- 180

  Fly   300 EGFRMDECQNVYSSQDILL---EDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVS 361
             ...::.|       |.|:   ..:::|...:....:|.||||||.:  ..|:|      .||..
  Fly   181 -SISLERC-------DELIGWGVQSELCLIHEADNGACNGDSGGPAV--YNNQV------VGVAG 229

  Fly   362 FGPTPCGLAGWPGVYTLVGKYVDWIQN 388
            |..:.|| ..:|..|..|..:.:||:|
  Fly   230 FVWSACG-TSYPDGYARVYYHNEWIKN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 71/273 (26%)
Tryp_SPc 128..389 CDD:238113 73/276 (26%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 71/273 (26%)
Tryp_SPc 32..256 CDD:238113 73/276 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.