DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Ser6

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:293 Identity:76/293 - (25%)
Similarity:122/293 - (41%) Gaps:74/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LLPL---PGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHC 174
            :||:   ||:    |:.|:.||.....::||....:....|     |.||||:::..|::||:||
  Fly    18 VLPVQSAPGK----LNGRVVGGEDAVKNQFPHQVSLRNAGS-----HSCGGSILTRTYILTAAHC 73

  Fly   175 VNGKAL-----PTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPAS 234
            |:.:.:     |.......:|.|..|..:.        |:.        |.|...|.|.:|    
  Fly    74 VSNEDVNHVITPIAAERFTIRAGSNDRFSG--------GVL--------VQVAEVIVHEEY---- 118

  Fly   235 KNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFD---GITMDVAGWGKTEQ-------LS 289
            .|.:||:|||||...:..:..::||.||        |.|   .:.:.::|||:.:.       |.
  Fly   119 GNFLNDVALLRLESPLILSASIQPIDLP--------TVDTPADVDVVISGWGRIKHQGDLPRYLQ 175

  Fly   290 ASNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYY 354
            .:.||      .....:|:.:.   |...|. ::|...:....:|.||||||.:      .|.. 
  Fly   176 YNTLK------SITRQQCEELI---DFGFEG-ELCLLHQVDNGACNGDSGGPAV------YNNQ- 223

  Fly   355 FLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQ 387
             |.||..|....|| :.:|..|..|..:.|||:
  Fly   224 -LVGVAGFVVDGCG-STYPDGYARVFYFKDWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 69/273 (25%)
Tryp_SPc 128..389 CDD:238113 70/275 (25%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 69/273 (25%)
Tryp_SPc 32..256 CDD:238113 70/275 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.