DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG4653

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:244 Identity:64/244 - (26%)
Similarity:104/244 - (42%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 HHCGGSLISTRYVITASHCVN----GKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPH 216
            |.|||:||..::::||:|||:    .::.|.  :...||:|.....|....              
  Fly    48 HVCGGALIREKWILTAAHCVSLGGGQQSYPA--KSYNVRVGSIQRLTGGQL-------------- 96

  Fly   217 LDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAG 281
              ||:.:.|.|.:|..:.....||:|||.|...|.......||.|..:   |.|.  |..:..:|
  Fly    97 --VPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATE---RPAA--GSQIIFSG 154

  Fly   282 WGKTE-QLSASNLKLKAAVEGFRMDECQ-NVYSSQDILLEDTQMCAG--GKEGVDSCRGDSGGPL 342
            ||.:: ..|.|::...|..:.....:|| .:|..|:.||     |..  .::....|.||:|.|.
  Fly   155 WGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQEDLL-----CLSPVDEDFAGLCSGDAGAPA 214

  Fly   343 IGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI-QNTI 390
                  ..|..  |.|:.:|..:.|| :..|..|..|.::::|| :|.:
  Fly   215 ------SYNNQ--LVGIAAFFVSGCG-SEQPDGYVDVTQHLEWINENAV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 61/237 (26%)
Tryp_SPc 128..389 CDD:238113 63/241 (26%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 63/240 (26%)
Tryp_SPc 30..249 CDD:214473 61/237 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.