DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG9673

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:284 Identity:88/284 - (30%)
Similarity:128/284 - (45%) Gaps:54/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GNILS------NRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKA 179
            |.|||      .||.||......|:||.|.:.|.|:     |.|.|::|||.:::||:|||:...
  Fly    16 GLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKA-----HVCSGAIISTNHILTAAHCVSSVG 75

  Fly   180 L-PTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIAL 243
            : |.|.....||||..:.......                |.|:..|.||.|    .|.::|||:
  Fly    76 ITPVDASTLAVRLGTINQYAGGSI----------------VNVKSVIIHPSY----GNFLHDIAI 120

  Fly   244 LRLAQQVEYTDFVRPICLPLDVNLRSATFD-----GITMDVAGWGKTEQLSASNLKLKAAVEGFR 303
            |.|.:.:.::|.::.|.||...:..:...|     |..:.|||||:....:||..:.||......
  Fly   121 LELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLS 185

  Fly   304 MDEC--QNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTP 366
            ...|  :..|..:.:      :|....||...||||:|..:|  |.:||     |.|:.||...|
  Fly   186 RSLCEWEAGYGYESV------VCLSRAEGEGICRGDAGAAVI--DDDKV-----LRGLTSFNFGP 237

  Fly   367 CGLAGWPGVYTLVGKYVDWIQ-NT 389
            || :.:|.|.|.|..|:.||: ||
  Fly   238 CG-SKYPDVATRVSYYLTWIEANT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 80/266 (30%)
Tryp_SPc 128..389 CDD:238113 81/269 (30%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 80/266 (30%)
Tryp_SPc 29..259 CDD:238113 81/268 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.