DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG9676

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:275 Identity:84/275 - (30%)
Similarity:120/275 - (43%) Gaps:55/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 QCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHH-CGGSLISTRYVITASHCVNGKALPT 182
            |..:::..||.||.|.:..:||      :..|..::|.| ||||:||..||:||:|||       
  Fly    19 QNDSVVEPRIVGGTKAREGQFP------HQISLRRRGSHTCGGSIISKDYVVTAAHCV------- 70

  Fly   183 DWRLSGVRLGEWDTNTNPDCEVDVR-GMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRL 246
                      :...|..|..|:::: |....:...:.|||.....||:|    .:..:|:|:|||
  Fly    71 ----------KQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNY----NSNGHDVAVLRL 121

  Fly   247 AQQVEYTDFVRPICLPLDVNLRSATFD---GITMDVAGWGKTEQLS-ASNLKLKAAVEGFRMDEC 307
            ...:.:...:..|.|        ||.|   ..|:|::|||...|.. .||..|...|:....:.|
  Fly   122 RNSLTFNSNIAAIKL--------ATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESC 178

  Fly   308 QNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYY-FLAGVVSFGPTPCGLAG 371
            |..|..|   |.:|.||....:...:|.||||||.         ||. .|.|:.||....||.|.
  Fly   179 QKTYLRQ---LPETTMCLLHPKDKGACYGDSGGPA---------TYQGKLVGLASFVIGGCGRAA 231

  Fly   372 WPGVYTLVGKYVDWI 386
             |..|..|.|..:||
  Fly   232 -PDGYERVSKLRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 81/265 (31%)
Tryp_SPc 128..389 CDD:238113 82/266 (31%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 81/265 (31%)
Tryp_SPc 28..248 CDD:238113 82/266 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.