DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG33127

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:277 Identity:77/277 - (27%)
Similarity:114/277 - (41%) Gaps:71/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 IDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCV------NGKALPTDWRLSGVRLGEW 194
            :|..|::..:..|::  ...|.||.|:|..|:::||:|||      ||.|:.|. ..:|:     
  Fly    50 VDNVPYLVSLSLTRA--TYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTP-VYAGI----- 106

  Fly   195 DTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVND-IALLRLAQQVEYTDFVRP 258
             .|.:......||.: |.|..|...              :.|..:| ||||.:::..||...|:.
  Fly   107 -INRSNVTAAQVRYV-DFASTHRSF--------------NGNAGSDNIALLHVSESFEYNARVQQ 155

  Fly   259 ICLPLDVNLRSATFDGITMDVAGWGKTE--------QLSASNLKLKAAVEGFRMDECQNVYSSQD 315
            |.|| |:|   ..:...|....|||.|:        :|..:...|      .....|:.:..: |
  Fly   156 IALP-DIN---DDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPL------LNSTGCKELLPA-D 209

  Fly   316 ILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYF-------LAGVVSFGPTPCGLAGWP 373
            ..|...|:|:    .|.:|.||.|.|||          |:       |.|:.|:...|||.|..|
  Fly   210 APLTAQQVCS----QVKTCYGDGGTPLI----------YWPITGPAELVGLGSWSYMPCGYANRP 260

  Fly   374 GVYTLVGKYVDWIQNTI 390
            .|||.|..|:.||..||
  Fly   261 TVYTSVPPYIGWIHQTI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 73/271 (27%)
Tryp_SPc 128..389 CDD:238113 75/274 (27%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 75/274 (27%)
Tryp_SPc 41..273 CDD:214473 73/271 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.