DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG32376

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:316 Identity:81/316 - (25%)
Similarity:133/316 - (42%) Gaps:67/316 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YRESSSETTPPPKPNVTSNSLLPLPGQCGNILSN--------------RIYGGMKTKIDEFPWMA 143
            |:::.:......||    ..:.|.| ..|||.||              ||..|.:....|.|:..
  Fly    22 YKDNGTHYLLYGKP----EDIAPTP-NFGNISSNPFINALEAQESFPTRIVNGKRIPCTEAPFQG 81

  Fly   144 LIEYTKSQGKKGHH-CGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVR 207
            .:.|      :|:. ||..:|:..:::||.||..|.  |..:.   ||:|........    .:|
  Fly    82 SLHY------EGYFVCGCVIINKIWILTAHHCFFGP--PEKYT---VRVGSDQQRRGG----QLR 131

  Fly   208 GMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATF 272
            .:|         .:.....:.||     ...:|:|:::|...|.:...|||:.||   :.::..|
  Fly   132 HVK---------KIVALAAYNDY-----TMRHDLAMMKLKSPVYFGKCVRPVKLP---STKTTKF 179

  Fly   273 DGITMDVAGWGKTEQLSASNLK---LKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSC 334
            .. ...|:|||.| ..:|.|::   .:..::..:..:||.:|....:.:....:|| .:...|||
  Fly   180 PK-KFVVSGWGIT-SANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICA-SRTNKDSC 241

  Fly   335 RGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            .|||||||    |::...|    |:||:| ..|....:||||....:||.||:..|
  Fly   242 SGDSGGPL----TSRGVLY----GIVSWG-IGCANKNYPGVYVNCKRYVPWIKKVI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 68/262 (26%)
Tryp_SPc 128..389 CDD:238113 69/264 (26%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 68/262 (26%)
Tryp_SPc 66..287 CDD:238113 69/264 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.