DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG32260

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:373 Identity:115/373 - (30%)
Similarity:162/373 - (43%) Gaps:77/373 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 YLSRSQCGYTNGKVLICCPD------RYRE-------------------SSSETTP------PPK 105
            :|.:|.||:.....::||..      |.|:                   ..|..||      ||.
  Fly   227 FLGQSICGFDGSTFMVCCATDRSGNARSRKDVFVTTAAPFGFFHFSPLSGGSTATPMVFQPTPPL 291

  Fly   106 PNVTSNSLLPLP------------GQCG--NILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKG- 155
            ..|.|.|..|.|            ..||  ...|||:.|||:.:...:||:|.:.|.:...:.. 
  Fly   292 SQVVSPSFYPPPPPPPPNNAPRESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNAL 356

  Fly   156 -HHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDV 219
             ..||||||.:|||||::||:|.       .|:.||||..|.:...:...            :|:
  Fly   357 KFLCGGSLIHSRYVITSAHCINP-------MLTLVRLGAHDLSQPAESGA------------MDL 402

  Fly   220 PVERTIPHPDYIPASKNQV-NDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWG 283
            .:.||:.|..:   ..|.: |||||:.|.........:.|||||.........|.|:...|||||
  Fly   403 RIRRTVVHEHF---DLNSISNDIALIELNVVGALPGNISPICLPEAAKFMQQDFVGMNPFVAGWG 464

  Fly   284 KTEQLSASNLKLK-AAVEGFRMDECQNVYSS--QDILLEDTQMCAGGKEGVDSCRGDSGGPLIGL 345
            ..:....::..|: |.|.......|:..|.|  |.:...|..:|| |...||:|:|||||||: :
  Fly   465 AVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCA-GSSSVDACQGDSGGPLM-M 527

  Fly   346 DTNKVNTY-YFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIES 392
            ...:.|.| ::|.|:|||| ..|....:|||||.|..||.||:..|.|
  Fly   528 PQLEGNVYRFYLLGLVSFG-YECARPNFPGVYTRVASYVPWIKKHIAS 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 4/16 (25%)
Tryp_SPc 127..386 CDD:214473 89/265 (34%)
Tryp_SPc 128..389 CDD:238113 90/267 (34%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855 4/16 (25%)
Tryp_SPc 327..568 CDD:214473 89/265 (34%)
Tryp_SPc 328..571 CDD:238113 90/267 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.