DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and F10

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:408 Identity:102/408 - (25%)
Similarity:160/408 - (39%) Gaps:107/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SIIC-----LFLGILAKSSAGQFYFPNEAAQVPNYGRCITPNRERALCIHLEDCKYLYGLLTTTP 64
            |::|     .|||...||......||           |...|:.||        |....|.|:..
  Rat   146 SVVCSCAKGYFLGNDGKSCLSTAPFP-----------CGKTNKGRA--------KRSVALNTSNS 191

  Fly    65 -------LRDTDRLYLSRSQCGYTNGKVLICCPDRYRESSSE--TTPPPKPNVTSNSLLPLPGQC 120
                   :.|.|.||.:                    ||.||  .....:|...|:.::      
  Rat   192 EPDPEDLMPDADILYPT--------------------ESPSELLNLNKTEPEANSDDVI------ 230

  Fly   121 GNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWR 185
                  ||.||.:.|..|.||.||:   .|..:....|||::::..|::||:||::      ..:
  Rat   231 ------RIVGGQECKRGECPWQALL---FSDEETDGFCGGTILNEFYILTAAHCLH------QAK 280

  Fly   186 LSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVN----DIALLRL 246
            ...||:|:.:|......|:          .|   .|:..|.|      :|.|.:    |||:|||
  Rat   281 RFKVRVGDLNTEQEDGGEM----------VH---EVDMIIKH------NKFQRDTYDFDIAMLRL 326

  Fly   247 AQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLK-AAVEGFRMDECQNV 310
            ...:.:.:.|.|.|||......:......|..|:|:|:|.:....:..|| ..|.....:.|:  
  Rat   327 KTPITFRENVAPACLPQKDWAEATLMTQKTGIVSGFGRTHEKGRQSKVLKMMEVPYVDRNTCR-- 389

  Fly   311 YSSQDILLEDTQMCAG-GKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPG 374
             .|....:.....||| ..:..|:|:||||||.:    .:....||:.|:||:| ..|...|..|
  Rat   390 -LSTSFSITQNMFCAGYDAKQEDACQGDSGGPHV----TRFKDTYFVTGIVSWG-EGCARKGKYG 448

  Fly   375 VYTLVGKYVDWIQNTIES 392
            :||.|..::.||..::::
  Rat   449 IYTKVTAFLKWIDRSMKA 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 11/58 (19%)
Tryp_SPc 127..386 CDD:214473 74/264 (28%)
Tryp_SPc 128..389 CDD:238113 75/266 (28%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372 6/17 (35%)
Tryp_SPc 232..462 CDD:238113 75/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.