DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Prss34

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:311 Identity:98/311 - (31%)
Similarity:132/311 - (42%) Gaps:81/311 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SLLPLPGQCGNILSNRIYGGMKTKIDEFPW-MALIEYTKSQGKKGHHCGGSLISTRYVITASHCV 175
            |.:||....|..|.. |.||.......||| ::|..|.....|..|.||||||..::|:||:|||
  Rat    18 STMPLTPDSGQELVG-IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCV 81

  Fly   176 NGKALPTDW---RLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDY-----IP 232
            ..|.:....   ::..:||.|.|           :.||          |.:.|.||.:     .|
  Rat    82 ELKEMEASCFRVQVGQLRLYEND-----------QLMK----------VAKIIRHPKFSEKLSAP 125

  Fly   233 ASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKA 297
            ...    |||||:|...|..::.|.|:.||......|:.   .|..|||||              
  Rat   126 GGA----DIALLKLDSTVVLSERVHPVSLPAASQRISSK---KTWWVAGWG-------------- 169

  Fly   298 AVEGFR-----------------MDECQ---NVYSSQD---ILLEDTQMCAGGKEGVDSCRGDSG 339
            .:||.|                 ..:|:   ..|||.|   .:::|..:|| |.||.|||:.|||
  Rat   170 VIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCA-GMEGRDSCQADSG 233

  Fly   340 GPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            |||:    .:.|..:...||||:| ..|||..:|||||.|..|:.||...:
  Rat   234 GPLV----CRWNCSWVQVGVVSWG-IGCGLPDFPGVYTRVMSYLSWIHGYV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 91/290 (31%)
Tryp_SPc 128..389 CDD:238113 93/292 (32%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 92/290 (32%)
Tryp_SPc 33..275 CDD:214473 91/289 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.