DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Prss29

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:297 Identity:89/297 - (29%)
Similarity:137/297 - (46%) Gaps:50/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 NSLLPLPGQCGNILSNRIYGGMKTKIDEFPW-MALIEYTKSQGKKGHHCGGSLISTRYVITASHC 174
            :|:..:|......:...|.||......::|| ::|..|..:.....|.||||:|..::|:||:||
  Rat    14 SSIAGIPASVPEDVLVGIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHC 78

  Fly   175 VN-GKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQV 238
            :: ..|.|:.:|   :.||          :|.:.|.:..      :.|.|.|.|||::.:...  
  Rat    79 IHESDADPSAFR---IYLG----------QVYLYGGEKL------LKVSRVIIHPDFVRSGLG-- 122

  Fly   239 NDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMD---VAGWGKT---EQLSASNLKLKA 297
            :|:|||:|||.|.....|:|      |.|..|:.:....|   |.|||..   |.|.......:.
  Rat   123 SDVALLQLAQSVRSFPNVKP------VKLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQV 181

  Fly   298 AVEGFRMDECQNVYSS--------QDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYY 354
            .|:......|:.:|.:        |.::|:| .:|| |..|.|||.|||||||:    ..|...:
  Rat   182 QVKIVDNTLCEKLYRNATRLSNHGQRLILQD-MLCA-GSHGRDSCYGDSGGPLV----CNVTGSW 240

  Fly   355 FLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIE 391
            .|.||||:| ..|.|...||||..|..::.||...::
  Rat   241 TLVGVVSWG-YGCALKDIPGVYARVQFFLPWITGQMQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 85/274 (31%)
Tryp_SPc 128..389 CDD:238113 87/276 (32%)
Prss29XP_017453326.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.