DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Prss30

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:290 Identity:93/290 - (32%)
Similarity:135/290 - (46%) Gaps:50/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LPGQCGNIL---SNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNG 177
            |.|..|:||   :.:|.||.......:||...:.    ..|:||.||||||...:|:||:||.  
  Rat    16 LTGGRGDILHSGAGKIVGGQDAPEGRWPWQVSLR----TEKEGHICGGSLIHEVWVLTAAHCF-- 74

  Fly   178 KALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMK-DCAPPHLD-VPVERTIPHPDYI--PASKNQV 238
             ..|.:.....|::|               |:. ....||.. |.|.....:|.|:  .||.   
  Rat    75 -CRPLNSSFYHVKVG---------------GLTLSLTEPHSTLVAVRNIFVYPTYLWEDASS--- 120

  Fly   239 NDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFR 303
            .|||||||...::.:.| .|:|||   ..::....|....|.|||.|.:...:::..:.||....
  Rat   121 GDIALLRLDTPLQPSQF-SPVCLP---QAQAPLTPGTVCWVTGWGATHERELASVLQELAVPLLD 181

  Fly   304 MDECQNVY-------SSQDILLEDTQMCAGGKEG-VDSCRGDSGGPLIGLDTNKVNTYYFLAGVV 360
            .::|:.:|       |.:.::..| .:|||..|| .|||:|||||||:    ..:|:.:...|:.
  Rat   182 SEDCERMYHIGETSLSGKRVIQSD-MLCAGFVEGQKDSCQGDSGGPLV----CAINSSWIQVGIT 241

  Fly   361 SFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            |:| ..|.....|||||.|..||||||.|:
  Rat   242 SWG-IGCARPNKPGVYTRVPDYVDWIQRTL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 84/270 (31%)
Tryp_SPc 128..389 CDD:238113 87/272 (32%)
Prss30NP_955403.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.