DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and f10

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_958870.3 Gene:f10 / 282670 ZFINID:ZDB-GENE-021206-9 Length:504 Species:Danio rerio


Alignment Length:291 Identity:87/291 - (29%)
Similarity:144/291 - (49%) Gaps:50/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VTSNSLLPLPGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITAS 172
            :....:||:....|:   .||..|::....:.||.||:....:.|    .|||::::..::::|:
Zfish   228 IEEEPILPVVSTAGD---GRIVNGVECPPGDCPWQALLINENNMG----FCGGTILTEHFILSAA 285

  Fly   173 HCVNGKALPTDWRLS-GVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKN 236
            ||:|..       || .|.:||:||......|.          .|   .|:..:.|.:|.|.:.:
Zfish   286 HCMNES-------LSIRVVVGEYDTLVPEGREA----------TH---DVDEILIHKNYQPDTYH 330

  Fly   237 QVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATF----DGITMDVAGWGKTEQ--LSASNLKL 295
              |||||::|::.:::|.::.|.||| ::.......    ||:   |:|:|:..:  ||::.|: 
Zfish   331 --NDIALIKLSKPIKFTKYIIPACLP-EMKFAERVLMQQDDGL---VSGFGRVREGGLSSTILQ- 388

  Fly   296 KAAVEGFRMDECQNVYSSQDILLEDTQMCAG-GKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGV 359
            |..|......:|   ..|.:..:.....||| .:|..|:|:||||||.:   |...|| :|:.||
Zfish   389 KLTVPYVNRAKC---IESSNFKISGRMFCAGYDQEEKDACQGDSGGPHV---TRFKNT-WFITGV 446

  Fly   360 VSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            ||:| ..|...|..||||.|.||:.||.|.:
Zfish   447 VSWG-EGCARKGKYGVYTQVSKYIMWINNAM 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 81/266 (30%)
Tryp_SPc 128..389 CDD:238113 82/268 (31%)
f10NP_958870.3 GLA 19..82 CDD:214503
EGF_CA 83..119 CDD:238011
FXa_inhibition 126..161 CDD:291342
Tryp_SPc 244..472 CDD:214473 81/266 (30%)
Tryp_SPc 245..474 CDD:238113 82/267 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.