DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG33225

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:298 Identity:99/298 - (33%)
Similarity:139/298 - (46%) Gaps:68/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LPGQCGNILS----NRIYGGMKTKIDEF--PWMALIEYTKSQGKKGHHCGGSLISTRYVITASHC 174
            |...||....    .|:.||  ...|.|  |||.::     .|:....|.||||:..:|:|::.|
  Fly    41 LTNDCGTTRHPSRIRRVVGG--NDADRFANPWMVMV-----LGENNVFCSGSLITRLFVLTSASC 98

  Fly   175 VNGKALPTDWRLSGVRLGEWDTN-TNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDY-IPASKNQ 237
            :  .:||..     |.|||:|.| |:.|| ..:|.:.|         :::.|.|..: :...|..
  Fly    99 L--LSLPKQ-----VILGEYDRNCTSADC-TSIRQVID---------IDQKIIHGQFGLETVKKY 146

  Fly   238 VNDIALLRLAQQVEYTDFVRPICLPLDVNL-RSATFDGITMDVAGWGKTEQLSASNLKLKAAVEG 301
              ||||||||::|..:|:||||||.:|..: ||...    ....|||.||....|.:.....:..
  Fly   147 --DIALLRLAKKVSISDYVRPICLSVDRQVGRSVQH----FTATGWGTTEWNEPSTILQTVTLSK 205

  Fly   302 FRMDEC-----QNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPL---IGLD-----TNKVNTY 353
            .....|     ||:.:|        |:|.||.. .|:|.||:||||   :.:|     .||... 
  Fly   206 INRKYCKGRLRQNIDAS--------QLCVGGPR-KDTCSGDAGGPLSLTLKIDGDGKWNNKSRA- 260

  Fly   354 YFLAGVVSFGPTPC-GLAGWPGVYTLVGKYVDWIQNTI 390
             ||.|:||:|.:.| |:    ||||.|..|:|||..||
  Fly   261 -FLIGIVSYGSSSCSGI----GVYTNVEHYMDWIVRTI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 92/277 (33%)
Tryp_SPc 128..389 CDD:238113 93/279 (33%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 92/277 (33%)
Tryp_SPc 57..292 CDD:238113 93/279 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.