DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Tpsg1

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:329 Identity:103/329 - (31%)
Similarity:151/329 - (45%) Gaps:57/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NGKVLICC--------PDRYRESSSETTPPPK---PNVTSNSLLPLPGQCGN-ILSN---RIYGG 131
            ||..:..|        .:.::.::|:.|...:   |:..:||:....| ||: .:||   ||.||
Mouse    27 NGHWIHLCHGLQGPGLAESFQWATSKPTVSARGQYPDSLANSVSSGSG-CGHPQVSNSGSRIVGG 90

  Fly   132 MKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDT 196
            .......:||.|.:..     .|.|.|||||:|..:|:||:||.:|....:|::   |.|||...
Mouse    91 HAAPAGTWPWQASLRL-----HKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQ---VHLGELTV 147

  Fly   197 NTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICL 261
            ..:               ||... |:|.|.:.. .|.......||||::|:..|..:..|:|:||
Mouse   148 TLS---------------PHFST-VKRIIMYTG-SPGPPGSSGDIALVQLSSPVALSSQVQPVCL 195

  Fly   262 PLDVNLRSATF-DGITMDVAGWGKT---EQLSASNLKLKAAVEGFRMDECQNVYSSQD-ILLEDT 321
            |    ..||.| .|:...|.|||.|   |.|.......:|.|....:..|...|:|.: .|::..
Mouse   196 P----EASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPD 256

  Fly   322 QMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI 386
            .:||.|..  |:|:.||||||:    .:|...:..|||||:| ..||....||||..|..||:||
Mouse   257 MLCARGPG--DACQDDSGGPLV----CQVAGTWQQAGVVSWG-EGCGRPDRPGVYARVTAYVNWI 314

  Fly   387 QNTI 390
            .:.|
Mouse   315 HHHI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 2/6 (33%)
Tryp_SPc 127..386 CDD:214473 87/263 (33%)
Tryp_SPc 128..389 CDD:238113 88/265 (33%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 88/265 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.