DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and PRSS33

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:292 Identity:97/292 - (33%)
Similarity:139/292 - (47%) Gaps:68/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 CGN-ILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTD 183
            ||. .:|:||.||...:..|:||.|.|::     :..|.||||||:.::|:||:||...:|||.:
Human    28 CGQPRMSSRIVGGRDGRDGEWPWQASIQH-----RGAHVCGGSLIAPQWVLTAAHCFPRRALPAE 87

  Fly   184 W--RLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRL 246
            :  ||..:|||                  ..:|..|.|||.|.:..|||  :......|:|||:|
Human    88 YRVRLGALRLG------------------STSPRTLSVPVRRVLLPPDY--SEDGARGDLALLQL 132

  Fly   247 AQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAV--------EGFR 303
            .:.|..:..|:|:|||:.   .:....|....|.|||          .|:..|        :|.|
Human   133 RRPVPLSARVQPVCLPVP---GARPPPGTPCRVTGWG----------SLRPGVPLPEWRPLQGVR 184

  Fly   304 MD-----ECQNVY-------SSQDILLEDTQMCAGGKEG-VDSCRGDSGGPLIGLDTNKVNTYYF 355
            :.     .|..:|       .::.|:|..: :|||..:| .|:|:|||||||..|.:..    :.
Human   185 VPLLDSRTCDGLYHVGADVPQAERIVLPGS-LCAGYPQGHKDACQGDSGGPLTCLQSGS----WV 244

  Fly   356 LAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQ 387
            |.||||:| ..|.|...|||||.|..|..|||
Human   245 LVGVVSWG-KGCALPNRPGVYTSVATYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 91/281 (32%)
Tryp_SPc 128..389 CDD:238113 93/283 (33%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 91/281 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.