DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG30289

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:297 Identity:103/297 - (34%)
Similarity:153/297 - (51%) Gaps:58/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NVTSNSLLPLPGQCGNILSN------RIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLIST 165
            ||.|..|:.   .||  :|.      .|:||.||.|.|.|||.|:..:|.       ||||||:.
  Fly    20 NVMSRLLVE---NCG--ISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKP-------CGGSLIAR 72

  Fly   166 RYVITASHCVNGKALPTDWRLSGVRLGEWDT-NTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPD 229
            ::|:||:|||:.:.|       .||||:::| :..|.|.     ...|.|...::.|:..|.|.:
  Fly    73 QFVLTAAHCVSFEDL-------YVRLGDYETLDPMPYCL-----NNHCIPKFYNISVDMKIVHEN 125

  Fly   230 YIPASKNQV---NDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSAS 291
            |     |.:   |||||||:::.|||:|:||||||.:...::|...    ..|.|||:||....|
  Fly   126 Y-----NGITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIPM----FTVTGWGETEYGQFS 181

  Fly   292 NLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPL-----IGLDTNKVN 351
            .:.|.|.:....:..|...::.|   .:.:|:|||.... ::|:|||||||     .|   |::.
  Fly   182 RILLNATLYNMDISYCNIKFNKQ---ADRSQICAGSHTS-NTCKGDSGGPLSSKFHYG---NRLL 239

  Fly   352 TYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQN 388
            ::.:  |:||:|...|. |...||||.|..:.:||.|
  Fly   240 SFQY--GLVSYGSERCA-ANVAGVYTNVSYHREWIFN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 93/267 (35%)
Tryp_SPc 128..389 CDD:238113 96/270 (36%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 93/266 (35%)
Tryp_SPc 42..271 CDD:238113 93/266 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.