DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG30287

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:287 Identity:96/287 - (33%)
Similarity:138/287 - (48%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LPGQCGNILSN----RIYGGMKTKIDEFPWMALIEYTKSQGKKG-HHCGGSLISTRYVITASHCV 175
            |..||....|.    |:..|....:...|||.:|.      ::| ..||||||:.|||:||:||.
  Fly    26 LDPQCVTARSEPGLYRVINGKPADLFSNPWMVIII------ERGMMKCGGSLITPRYVLTAAHCK 84

  Fly   176 NGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPA--SKNQV 238
            :    .|..:|: ||||::|.|...||     ....|.|...::.|.||     |:|:  :..:.
  Fly    85 S----ETKSQLT-VRLGDYDVNQAVDC-----SSYGCIPRPREINVTRT-----YVPSHYTNFRK 134

  Fly   239 NDIALLRLAQQVEYTDFVRPICLPL-DVNLRSATFDG-ITMDVAGWGKTEQLSASNLKLKAAVEG 301
            ||||||||...|:|.|.:|.|||.: |....|..... :..:..|||:||....|.:..:|::..
  Fly   135 NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTH 199

  Fly   302 FRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPL-----IGLDTNKVNTYYFLAGVVS 361
            ..:..|..|:..|   |:.:.:|.....| .:|:|||||||     ||.:...:     |.||||
  Fly   200 HHLSYCAQVFGKQ---LDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVI-----LFGVVS 255

  Fly   362 FGPTPC-GLAGWPGVYTLVGKYVDWIQ 387
            :|...| |    |.|||.|..:.:||:
  Fly   256 YGAVHCFG----PTVYTNVIHFANWIE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 90/269 (33%)
Tryp_SPc 128..389 CDD:238113 91/271 (34%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 90/269 (33%)
Tryp_SPc 42..280 CDD:238113 91/271 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.