DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG30083

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:302 Identity:83/302 - (27%)
Similarity:129/302 - (42%) Gaps:69/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PNVTSNSLLPLPGQCG-NILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVI 169
            |...|..|.|   .|| ..:|.:|..|...:....||||.|.....:......|||:||..::|:
  Fly    14 PGAMSQFLEP---NCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVL 75

  Fly   170 TASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPAS 234
            :|:||:...      ::..|||||..::.                               |...:
  Fly    76 SAAHCIKRD------QILAVRLGEHSSSR-------------------------------YFAVT 103

  Fly   235 K----------NQVNDIALLRLAQQVEYTDFVRPICLPLD----VNLRSATFDGITMDVAGWGKT 285
            |          :..|||.:||:...|::...:||||:..|    .|::       |...||||||
  Fly   104 KAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVK-------TFKAAGWGKT 161

  Fly   286 EQLSASNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKV 350
            |..:.|.:.....:......||.|:..   :.:.::|:|||..:| |:|.||||||||.......
  Fly   162 ENETFSKVLKTVELNELNASECYNMLW---VNVTESQICAGHPDG-DTCAGDSGGPLIHPVYMDG 222

  Fly   351 NTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIES 392
            :..|...|::|||.:.|..   |||||.:..::|||...:::
  Fly   223 SLRYVQLGIISFGSSLCNS---PGVYTRLSSFIDWILMVVDN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 74/272 (27%)
Tryp_SPc 128..389 CDD:238113 76/274 (28%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 74/272 (27%)
Tryp_SPc 34..255 CDD:238113 74/271 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.