DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG30082

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:310 Identity:100/310 - (32%)
Similarity:141/310 - (45%) Gaps:59/310 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LICCPDRYRESSSETTPPPKPNVTSNSLLPLPGQCGNIL----SNRIYGGMKTKIDEFPWMALIE 146
            |:|...:.|....:      ||            ||..:    :|||.||....|...||:|.:.
  Fly    12 LVCLTPKLRAQFID------PN------------CGTTINLPPTNRIVGGRTADIGSNPWLAYLH 58

  Fly   147 YTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKD 211
            ...|.     .|.|:||:.|:|:||:||::      .:.|..|||||:||:|..||..:.     
  Fly    59 KNSSL-----VCTGTLITKRFVLTAAHCLH------SFHLLTVRLGEYDTSTRIDCTSEF----- 107

  Fly   212 CAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICL---PLDVNLRSATFD 273
            |.|.:.:..||....| .:....::..|||.||:|...|.|..|:|||||   |..|...|    
  Fly   108 CIPTYEEYSVENAYIH-TFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSS---- 167

  Fly   274 GITMDVAGWGKTEQLSASNLKLKAAVEGFRMD--ECQNVYSSQDILLEDTQMCAGGKEGVDSCRG 336
              |.:.|||||.:.::.:.  :...|...|:|  :|:.   |....|...|.|| |:...|:|.|
  Fly   168 --TYEAAGWGKIDLINTAT--VLQTVNLIRLDQSDCER---SLRTSLSYGQFCA-GQWRADTCSG 224

  Fly   337 DSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI 386
            ||||||....:|...|.....|:||:|...|   ..|||||.|..:.:||
  Fly   225 DSGGPLSRKMSNGRITRTVQLGIVSYGHYLC---RGPGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 1/2 (50%)
Tryp_SPc 127..386 CDD:214473 90/263 (34%)
Tryp_SPc 128..389 CDD:238113 91/264 (34%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 90/263 (34%)
Tryp_SPc 40..274 CDD:238113 91/264 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.