DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and TPSD1

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:269 Identity:78/269 - (28%)
Similarity:105/269 - (39%) Gaps:87/269 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PLPGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKG----HHCGGSLISTRYVITASHCV 175
            |.|||.  :....|.||.:....::||...:..      :|    |.||||||..::|:||:|||
Human    27 PAPGQA--LQQTGIVGGQEAPRSKWPWQVSLRV------RGPYWMHFCGGSLIHPQWVLTAAHCV 83

  Fly   176 NGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCA-------PPHLD-----VPVERTIPHP 228
                                   .||       :||.|       ..||.     :||.|.|.||
Human    84 -----------------------EPD-------IKDLAALRVQLREQHLYYQDQLLPVSRIIVHP 118

  Fly   229 DYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATF-DGITMDVAGWGKTEQLSASN 292
            .:.......  |||||.|.:.|..:..:..:.||    ..|.|| .|:...|.|||..:    :|
Human   119 QFYIIQTGA--DIALLELEEPVNISSHIHTVTLP----PASETFPPGMPCWVTGWGDVD----NN 173

  Fly   293 LKL-------KAAVEGFRMDECQNVY--------SSQDILLEDTQMCAGGKEGVDSCRGDSGGPL 342
            :.|       :..|.......|...|        |.|  ::.|..:|| |.|..|||:|||||||
Human   174 VHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQ--IVRDDMLCA-GSENHDSCQGDSGGPL 235

  Fly   343 IGLDTNKVN 351
            :    .|||
Human   236 V----CKVN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 74/257 (29%)
Tryp_SPc 128..389 CDD:238113 74/256 (29%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 74/256 (29%)
Tryp_SPc 38..240 CDD:214473 72/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.