DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and F10

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:418 Identity:113/418 - (27%)
Similarity:173/418 - (41%) Gaps:92/418 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EAAQVPNYGRCITPNRERALCIHLE-----DCKYLYGLLTTTPLRDTDRLYLSRSQ------C-- 78
            |.:...|.|:|.....|.. |..||     :|:.....|.:....|.|: :....|      |  
Human    91 ETSPCQNQGKCKDGLGEYT-CTCLEGFEGKNCELFTRKLCSLDNGDCDQ-FCHEEQNSVVCSCAR 153

  Fly    79 GYT---NGKVLICCP-----------DRYRESSSETTPPP---------KP------NVTSN--S 112
            |||   |||.  |.|           :|.:.|.::.|...         ||      :.|.|  .
Human   154 GYTLADNGKA--CIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDPTENPFD 216

  Fly   113 LLPL----PGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASH 173
            ||..    |.:..|.|: ||.||.:.|..|.||.||:...:::|    .|||:::|..|::||:|
Human   217 LLDFNQTQPERGDNNLT-RIVGGQECKDGECPWQALLINEENEG----FCGGTILSEFYILTAAH 276

  Fly   174 CV-NGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQ 237
            |: ..|...       ||:|:.:|......|.          .|   .||..|.|..:   :|..
Human   277 CLYQAKRFK-------VRVGDRNTEQEEGGEA----------VH---EVEVVIKHNRF---TKET 318

  Fly   238 VN-DIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLK-AAVE 300
            .: |||:|||...:.:...|.|.|||......|......|..|:|:|:|.:....:.:|| ..|.
Human   319 YDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVP 383

  Fly   301 GFRMDECQNVYSSQDILLEDTQMCAG-GKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGP 364
            ....:.|:   .|...::.....||| ..:..|:|:||||||.:    .:....||:.|:||:| 
Human   384 YVDRNSCK---LSSSFIITQNMFCAGYDTKQEDACQGDSGGPHV----TRFKDTYFVTGIVSWG- 440

  Fly   365 TPCGLAGWPGVYTLVGKYVDWIQNTIES 392
            ..|...|..|:||.|..::.||..::::
Human   441 EGCARKGKYGIYTKVTAFLKWIDRSMKT 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 17/67 (25%)
Tryp_SPc 127..386 CDD:214473 77/262 (29%)
Tryp_SPc 128..389 CDD:238113 78/264 (30%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011 8/31 (26%)
FXa_inhibition 129..164 CDD:317114 10/37 (27%)
O-glycosylated at one site 183..203 3/19 (16%)
Tryp_SPc 235..464 CDD:238113 78/263 (30%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.