DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Prss27

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:313 Identity:100/313 - (31%)
Similarity:151/313 - (48%) Gaps:63/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KPNVTSNSLLPL------PG-----QCGN-ILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKG-H 156
            :|::.:..||||      .|     .||: .:.||:.||......|:||...|:      :.| |
Mouse     3 QPHIAALLLLPLLLRSGTEGARTLRACGHPKMFNRMVGGENALEGEWPWQVSIQ------RNGIH 61

  Fly   157 HCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAP-PH-LDV 219
            .||||||:..:|:||:||.:.   .:|..:..|.||               .:|...| || |.|
Mouse    62 FCGGSLIAPTWVLTAAHCFSN---TSDISIYQVLLG---------------ALKLQQPGPHALYV 108

  Fly   220 PVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFD-GITMDVAGWG 283
            ||::...:|.|...:.:.  |:||:.|...|.:|:::.|:|||..    |..|: |:...|.|||
Mouse   109 PVKQVKSNPQYQGMASSA--DVALVELQGPVTFTNYILPVCLPDP----SVIFESGMNCWVTGWG 167

  Fly   284 K-TEQLSASNLKL--KAAVEGFRMDECQNVYSSQDI-------LLEDTQMCAGGKEG-VDSCRGD 337
            . :||....|.::  |.||......:|..:| ::|:       .::|..:|||..|| .|:|:||
Mouse   168 SPSEQDRLPNPRVLQKLAVPIIDTPKCNLLY-NKDVESDFQLKTIKDDMLCAGFAEGKKDACKGD 231

  Fly   338 SGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            |||||:.|    |:..:..|||:|:| ..|.....||||..|..:..||...|
Mouse   232 SGGPLVCL----VDQSWVQAGVISWG-EGCARRNRPGVYIRVTSHHKWIHQII 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 88/273 (32%)
Tryp_SPc 128..389 CDD:238113 89/275 (32%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 88/273 (32%)
Tryp_SPc 39..278 CDD:238113 89/274 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.