DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Prss8

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:287 Identity:89/287 - (31%)
Similarity:139/287 - (48%) Gaps:54/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 CGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDW 184
            ||.::..||.||...|..::||...|.|...     |.|||||:|.::|::|:||...:....::
  Rat    37 CGAVIQPRITGGGSAKPGQWPWQVSITYNGV-----HVCGGSLVSNQWVVSAAHCFPREHSKEEY 96

  Fly   185 RLSGVRLG--EWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLA 247
            .   |:||  :.|:.:| |..|..              |.:.|.|..|  ..:....||||:||:
  Rat    97 E---VKLGAHQLDSFSN-DIVVHT--------------VAQIISHSSY--REEGSQGDIALIRLS 141

  Fly   248 QQVEYTDFVRPICLPLDVNLRSATF-DGITMDVAGWGKTEQLSASNLKLKA-------AVEGFRM 304
            ..|.::.::||||||    ..:|:| :|:...|.|||..    |.::.|:.       .|.....
  Rat   142 SPVTFSRYIRPICLP----AANASFPNGLHCTVTGWGHV----APSVSLQTPRPLQQLEVPLISR 198

  Fly   305 DECQNVYSSQDI-----LLEDTQMCAG-GKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFG 363
            :.|..:|:...:     .::...:||| .|.|.|:|:|||||||    :..::..::|||:||:|
  Rat   199 ETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPL----SCPIDGLWYLAGIVSWG 259

  Fly   364 PTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            .. ||....||||||...|..||.:.:
  Rat   260 DA-CGAPNRPGVYTLTSTYASWIHHHV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 85/274 (31%)
Tryp_SPc 128..389 CDD:238113 86/276 (31%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 85/274 (31%)
Tryp_SPc 45..284 CDD:238113 86/276 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.