DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Tpsb2

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:294 Identity:82/294 - (27%)
Similarity:115/294 - (39%) Gaps:84/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLG 192
            |.||.:....::||...:.:..:...  |.||||||..::|:||:|||.                
Mouse    32 IVGGHEASESKWPWQVSLRFKLNYWI--HFCGGSLIHPQWVLTAAHCVG---------------- 78

  Fly   193 EWDTNTNPDCEVDVRGMKDCAPPHLDVP--------------------VERTIPHPDYIPASKNQ 237
                                  ||:..|                    :.|.:.||.|..|....
Mouse    79 ----------------------PHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGA 121

  Fly   238 VNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATF-DGITMDVAGWGKTEQ-------LSASNLK 294
              |:|||.|...|..:..:.||.||    ..|.|| .|.:..|.|||..:.       .....:|
Mouse   122 --DVALLELEVPVNVSTHLHPISLP----PASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVK 180

  Fly   295 LKAAVEGFRMDECQN--VYSSQDI-LLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFL 356
            : ..||....|...:  :|:..|. ::.|..:|||.... |||:|||||||:    .||...:..
Mouse   181 V-PIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRR-DSCQGDSGGPLV----CKVKGTWLQ 239

  Fly   357 AGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            |||||:| ..|.....||:||.|..|:|||...:
Mouse   240 AGVVSWG-EGCAQPNKPGIYTRVTYYLDWIHRYV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 80/288 (28%)
Tryp_SPc 128..389 CDD:238113 82/291 (28%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 82/290 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.