DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Klk1b5

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_032482.1 Gene:Klk1b5 / 16622 MGIID:892020 Length:261 Species:Mus musculus


Alignment Length:288 Identity:91/288 - (31%)
Similarity:134/288 - (46%) Gaps:72/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 LSNRIYGGMKTKIDEFPW-MALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLS 187
            :.:||:||...:.:..|| :|:..:||.|      |||.|::..:|:||:||.|.|        .
Mouse    21 VQSRIFGGFNCEKNSQPWQVAVYRFTKYQ------CGGVLLNANWVLTAAHCHNDK--------Y 71

  Fly   188 GVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQ---------VNDIAL 243
            .|.||:  .|...|        :..|...|   |.:.|||||:..:..|:         .||:.|
Mouse    72 QVWLGK--NNFFED--------EPSAQHRL---VSKAIPHPDFNMSLLNEHTPQPEDDYSNDLML 123

  Fly   244 LRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGK--------TEQLSASNLKLKAAVE 300
            |||.:..:.||.|:||.||.:....     |.|...:|||.        .:.|...|.||     
Mouse   124 LRLKKPADITDVVKPIDLPTEEPKL-----GSTCLASGWGSITPVIYEPADDLQCVNFKL----- 178

  Fly   301 GFRMDECQNVYSSQDILLEDTQMCAGGKE-GVDSCRGDSGGPLI--GLDTNKVNTYYFLAGVVSF 362
             ...::|...:..:   :.|..:|||..: |.|:|.||||||||  |:          |.|:.|:
Mouse   179 -LPNEDCVKAHIEK---VTDVMLCAGDMDGGKDTCMGDSGGPLICDGV----------LHGITSW 229

  Fly   363 GPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            ||:|||....||:||.:.|:..||::||
Mouse   230 GPSPCGKPNVPGIYTKLIKFNSWIKDTI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 87/279 (31%)
Tryp_SPc 128..389 CDD:238113 88/281 (31%)
Klk1b5NP_032482.1 Tryp_SPc 24..253 CDD:214473 87/279 (31%)
Tryp_SPc 25..256 CDD:238113 88/281 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.