DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Prss29

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:301 Identity:92/301 - (30%)
Similarity:144/301 - (47%) Gaps:68/301 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PLPGQCGNILSNRIYGGMKTKIDEFPW-MALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGK 178
            |.||..|.::.  |.||......::|| ::|..|........|:||||:|..::|:||:||:..:
Mouse    20 PAPGPEGVLMG--IVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRER 82

  Fly   179 -ALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIA 242
             |.|:.:|   :|:|          |..:.|.|:.      :.|.|.|.|||::.|...  :|:|
Mouse    83 DADPSVFR---IRVG----------EAYLYGGKEL------LSVSRVIIHPDFVHAGLG--SDVA 126

  Fly   243 LLRLAQQVEYTDFVRPICLP---LDVNLRSATFDGITMDVAGWGKTE---------QLSASNLKL 295
            ||:||..|:....|:|:.||   |:|..:...:      |.|||...         :|....:|:
Mouse   127 LLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCW------VTGWGAVSTHRSLPPPYRLQQVQVKI 185

  Fly   296 KAAVEGFRMDE--CQNVYSS--------QDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKV 350
                    :|.  |:.:|.:        |.::|:| .:|| |.:|.|||.|||||||:    ..|
Mouse   186 --------IDNSLCEEMYHNATRHRNRGQKLILKD-MLCA-GNQGQDSCYGDSGGPLV----CNV 236

  Fly   351 NTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIE 391
            ...:.|.||||:| ..|.|..:||||..|..::.||...::
Mouse   237 TGSWTLVGVVSWG-YGCALRDFPGVYARVQSFLPWITQQMQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 86/282 (30%)
Tryp_SPc 128..389 CDD:238113 88/284 (31%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 88/284 (31%)
Tryp_SPc 31..271 CDD:214473 86/281 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.