DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and PRSS21

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:304 Identity:91/304 - (29%)
Similarity:136/304 - (44%) Gaps:62/304 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KPNVTSNSLLPLPGQCG-NILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYV 168
            ||.  |....||.|.|| .::::||.||...::..:||...:....|     |.||.||:|.|:.
Human    20 KPE--SQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDS-----HVCGVSLLSHRWA 77

  Fly   169 ITASHC---VNGKALPTDWRLSGVRLGE-------WDTNTNPDCEVDVRGMKDCAPPHLDVPVER 223
            :||:||   .:..:.|:.|.   |:.|:       |.....                :....|..
Human    78 LTAAHCFETYSDLSDPSGWM---VQFGQLTSMPSFWSLQAY----------------YTRYFVSN 123

  Fly   224 TIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMD---VAGWG-- 283
            ....|.|:   .|...||||::|:..|.||..::|||      |:::||:.....   |.|||  
Human   124 IYLSPRYL---GNSPYDIALVKLSAPVTYTKHIQPIC------LQASTFEFENRTDCWVTGWGYI 179

  Fly   284 -KTEQLSASNLKLKAAVEGFRMDECQNV---YSSQDILLEDTQMCAGGKE-GVDSCRGDSGGPLI 343
             :.|.|.:.:...:..|.......|.::   ||.:..:..| .:|||..: |.|:|.|||||||.
Human   180 KEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGD-MVCAGNAQGGKDACFGDSGGPLA 243

  Fly   344 GLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQ 387
               .|| |..::..||||:| ..||....|||||.:..:.:|||
Human   244 ---CNK-NGLWYQIGVVSWG-VGCGRPNRPGVYTNISHHFEWIQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 80/278 (29%)
Tryp_SPc 128..389 CDD:238113 82/280 (29%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 82/280 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.