DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Tpsab1

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:319 Identity:95/319 - (29%)
Similarity:132/319 - (41%) Gaps:96/319 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LLPLPGQCGNILSNRIY-------------GGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLIS 164
            ||.||     :||:.::             ||.:...:::||...:....:...  |.||||||.
Mouse     6 LLTLP-----LLSSLVHAAPGPAMTREGIVGGQEAHGNKWPWQVSLRANDTYWM--HFCGGSLIH 63

  Fly   165 TRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPD------CEVDVRGMKDCAPPHLDVPVER 223
            .::|:||:|||                       .||      ..|.:|........|| :.|.:
Mouse    64 PQWVLTAAHCV-----------------------GPDVADPNKVRVQLRKQYLYYHDHL-MTVSQ 104

  Fly   224 TIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATF-DGITMDVAGWGKTEQ 287
            .|.|||:.......  |||||:|...|..:|:|.|:.||    ..|.|| .|....|.|||..: 
Mouse   105 IITHPDFYIVQDGA--DIALLKLTNPVNISDYVHPVPLP----PASETFPSGTLCWVTGWGNID- 162

  Fly   288 LSASNLKLKAAVEGFRMDECQ---------------------NVYSSQDILLEDTQMCAGGKEGV 331
             :..||.     ..|.:.|.|                     ||:     ::.|..:|| |.||.
Mouse   163 -NGVNLP-----PPFPLKEVQVPIIENHLCDLKYHKGLITGDNVH-----IVRDDMLCA-GNEGH 215

  Fly   332 DSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            |||:|||||||:    .||...:..|||||:| ..|.....||:||.|..|:|||.:.:
Mouse   216 DSCQGDSGGPLV----CKVEDTWLQAGVVSWG-EGCAQPNRPGIYTRVTYYLDWIHHYV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 87/299 (29%)
Tryp_SPc 128..389 CDD:238113 89/301 (30%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 88/286 (31%)
Tryp_SPc 29..265 CDD:214473 87/285 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.