DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and proc.2

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:268 Identity:96/268 - (35%)
Similarity:136/268 - (50%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRL 191
            ||.|||:.::.:.||..||...:..|    .|||||||:|:|::|:||...: :|     ..|.:
 Frog   435 RIVGGMRCELGQCPWQVLIRNNRGFG----FCGGSLISSRWVLSAAHCFESQ-IP-----HHVTI 489

  Fly   192 GEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFV 256
            |::||...     |:...|        :.|.:...||:|:  ::...:|||||.|.....:.::.
 Frog   490 GDYDTYRR-----DMDEQK--------IAVLQVFSHPNYL--AEFYDHDIALLFLRSPAMFGEYS 539

  Fly   257 RPICLPLDVNLRSATFDGITMDVAGWGKTEQLSA-SNLKLKAAVEGFRMDECQNVYSSQDILLED 320
            ||||||.....:..|.:|.|..|:|||.|.|... :...||..:.....:.|.   :|.:.:|..
 Frog   540 RPICLPNPGLGKMLTQEGQTGQVSGWGATRQFGPYTRFLLKVRLPIVSQETCM---ASTENILTG 601

  Fly   321 TQMCAGGKEGV-DSCRGDSGGPLIGL--DTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKY 382
            ...|||.|||| |:|.||||||...|  ||      :||.||||:| ..|...|..||||.|..|
 Frog   602 NMFCAGYKEGVKDACSGDSGGPFAVLFHDT------WFLVGVVSWG-DGCAEKGKYGVYTRVANY 659

  Fly   383 VDWIQNTI 390
            :.||:.||
 Frog   660 MPWIKETI 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 92/262 (35%)
Tryp_SPc 128..389 CDD:238113 93/264 (35%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503
EGF_CA 81..117 CDD:238011
FXa_inhibition 123..160 CDD:373209
Tryp_SPc 436..666 CDD:238113 93/264 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.