DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6236 and CG32985

DIOPT Version :10

Sequence 1:NP_650446.2 Gene:CG6236 / 41857 FlyBaseID:FBgn0038318 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_788013.2 Gene:CG32985 / 326244 FlyBaseID:FBgn0052985 Length:644 Species:Drosophila melanogaster


Alignment Length:48 Identity:12/48 - (25%)
Similarity:23/48 - (47%) Gaps:1/48 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 VTEVDTSTLRKETLNQIDGLLGPSPEALELRQLLNSPHLASCVQALDV 470
            :|.::..|.|:..:.|:...:....:..|.:||.|.| ..|.|.:.:|
  Fly    53 ITNLEDETARQAEIEQLRTFIKSKLDKEEKQQLDNRP-FQSLVDSTEV 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6236NP_650446.2 DUF229 73..581 CDD:397236 12/48 (25%)
CG32985NP_788013.2 DUF229 72..554 CDD:397236 8/29 (28%)

Return to query results.
Submit another query.