DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and jigr1

DIOPT Version :9

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:225 Identity:42/225 - (18%)
Similarity:90/225 - (40%) Gaps:40/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIEIVQRDEAIYNPRHKYYFCRPYVENFWREVDLKLEKNPGASLAKWTNLRISF---RREYTNYL 94
            ||...:....:|:..:|.:..:.||.:.|.::..||..:..:...:.|.||..:   :|...|.|
  Fly    33 LIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVENGL 97

  Fly    95 EEKVPPCWSYFDRMFFLHPYLRK----KHQQPKSLDTQV-------QDALAHLSNLSSRMQRERS 148
            ..:... |..|:.:.||..::|.    |:...|..|.:.       .|:..|::::...::.:..
  Fly    98 STQSSQ-WPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELEDDSE 161

  Fly   149 V-----TIPGSSSIGGQPTPSAHQSPPAQQLDN--------YLDYFDEAEHNNSE------LDDI 194
            :     .:| .:::.|.|..::.::..:|:..|        | ::|.|:.|...:      :...
  Fly   162 IFDCEQALP-VTTVLGIPLNNSDEANKSQRSTNGEMPNGKGY-NHFAESYHRRHQNQPEYIISSP 224

  Fly   195 MEEEQQRNSRYHGQLDGNDIKSECEEPVDD 224
            :....:.|.|....||.:..|..    |||
  Fly   225 IVNPMRSNKRGSQHLDDHPSKRR----VDD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 19/85 (22%)
BESS 431..465 CDD:281011
jigr1NP_001097920.1 MADF 33..118 CDD:214738 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.