DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and hng2

DIOPT Version :9

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:310 Identity:58/310 - (18%)
Similarity:102/310 - (32%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 FDEAEHNNSELDDIMEEEQQRNSRYHGQLDGNDIKSECEEPV--------DDYEQEAHEPEEDE- 236
            |.:|.|..|    |:.|      |.|......:::.|..:.:        ||    :.|||:.| 
  Fly    21 FIDAVHKRS----IIWE------RSHPNFHNRELRDEAWQQIGHELCSNFDD----SSEPEKQEI 71

  Fly   237 --------QDDQDLHKMAPTSSSSSAEAQRRYANQHSHASRMLPGRLQMRTYHDEMRGAIRPRSQ 293
                    ::.:|.:........|..|..|.........|.:|..:.:.....:.::...:|:::
  Fly    72 VKTLLKRWKNTRDSYLRVNRLRQSGEEVARASYIYEKELSFLLNVKAESEDDVESLKEQPKPQAK 136

  Fly   294 ELQAPTAAVAGVNYSAQPTAHPNI---SFVRPTFSKPVDLVSTTTHAGGGGGGGVPGTAGLSEAE 355
            ..:..|||    ..||:.....|.   |.:.|....|....:..|         |.|..|.::.:
  Fly   137 RKRVSTAA----QRSAKTPRKRNSDQESNIEPAIRNPAIPSNINT---------VLGDLGCAKED 188

  Fly   356 LPTPSTAAVATPMAPSSSVSASSSSSYLSQRHGHNHMHGGHPQVPPSALPLRLEANNASGGSVSN 420
            ..||..|.:  |..||.. ..|::::|||                                    
  Fly   189 TATPEIAYI--PQLPSDP-PCSTNTAYLS------------------------------------ 214

  Fly   421 GGAELCDCKTDPDAMFLMSLLPDIQKLNGRDRGKIKIAFQ----NILQDY 466
                     .|||..|..::.|.:|::.. ||   |:.||    .||:::
  Fly   215 ---------ADPDQAFFDTIKPHMQQMCA-DR---KLDFQIEVLKILRNF 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738
BESS 431..465 CDD:281011 13/37 (35%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 20/105 (19%)
BESS 216..250 CDD:281011 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.