DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and Mes2

DIOPT Version :9

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster


Alignment Length:350 Identity:70/350 - (20%)
Similarity:113/350 - (32%) Gaps:134/350 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KLIEIVQRDEAIYNPRHKYYFCRPYVENF----------WREVDLKLEKNPGASLAK-WTNLRIS 85
            |||::|..:..:::.|         :.||          |..:..:... ||..:|: :.:||.|
  Fly    62 KLIQMVHDNPILWDSR---------LPNFKGAEEEKNRAWEHIGREFNA-PGRRVARAFKSLRES 116

  Fly    86 FRRE--YTNYLEEKVPPCWSYFDRMFFLHPYLRKK----HQQPKSLDTQVQDALAHLSN------ 138
            :|||  :...:.....|.||.::.|.||...:|::    |....||.|     ..|::|      
  Fly   117 YRRELAHVKLMGNGFKPKWSLYEAMDFLRDVIRERKGASHATDLSLTT-----YGHINNNNNNNN 176

  Fly   139 ---------------LSSRMQRERSV------------------------------------TIP 152
                           ||:......||                                    :..
  Fly   177 NSNSLAAGGKAMTLKLSNSFNESASVLNLSKCSSLNVSDDHYYCDYYVKPELDLSVGGGAGSSTS 241

  Fly   153 GSSSIGGQPTP-SAHQSPPAQQLDNYLDYFDEAEHNNSELDDIMEEEQQRNSRYHGQLDGNDIKS 216
            |||| ||.|.| .|||:                 ||:|.:.....|::.::..|. .:|.:.|:|
  Fly   242 GSSS-GGGPLPLPAHQA-----------------HNDSRVSSTRNEQRAQHHSYE-DMDDSSIRS 287

  Fly   217 ECEEPVDDYEQEAHEPEEDEQDDQDLHKMAPTSSSSSAEAQ------------RRYANQ------ 263
            ..|    |....:...||.:..|.|........|:|.....            ||..:|      
  Fly   288 GDE----DIAHASDVVEELDAIDADFPYPLILDSNSRGSPNVGVDDVVMSRKLRRNVDQDVLEEG 348

  Fly   264 HSHASRMLPG---RLQMRTYHDEMR 285
            :.|...::.|   ..||...|..:|
  Fly   349 NGHGDAVIDGDDYEEQMLQQHRHLR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 23/96 (24%)
BESS 431..465 CDD:281011
Mes2NP_730768.1 MADF 62..149 CDD:214738 23/96 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.