DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and CG6163

DIOPT Version :9

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001261709.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster


Alignment Length:189 Identity:37/189 - (19%)
Similarity:65/189 - (34%) Gaps:46/189 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WREVDLKLEKNPGASLAKWTNLRISF-----RREYTNYLEEKVPPCWSYFDRMFFLHPYLRKKHQ 120
            |:|..:::...|.....:|:.::..:     :..:..|..:.....|.:||||.|:...|.||..
  Fly   257 WKEAAMEMGLTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKKVD 321

  Fly   121 QPKSLDTQVQDALAHLSNLSSRMQRERSVTIPGSSSIGGQPTPSAH------QSPPAQQLDNYLD 179
            :.:....|:|:.::.        |:....|         |..||.|      ..|||..:::..|
  Fly   322 EREQTREQIQEIVSE--------QQHHQQT---------QHHPSQHLHHYRPPQPPAGLVEHAQD 369

  Fly   180 --------YFDEAEHNNSELDDIMEEEQQRNSRYHGQLDGNDIKSECEEPVDDYEQEAH 230
                    :..|..|...    .|...|      |.|.....:|.|.:...|.:|...|
  Fly   370 MPIGLVQHHHQEGHHPTL----AMHHPQ------HSQPIRRRVKHESDLEWDPFEMILH 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 11/59 (19%)
BESS 431..465 CDD:281011
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 11/58 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.