DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and CG6683

DIOPT Version :9

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster


Alignment Length:196 Identity:38/196 - (19%)
Similarity:69/196 - (35%) Gaps:38/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KLIEIVQRDEAIYNPRHKYYFCRPYVEN------FWREVDLKLEKNPGASLAKWTNLRISFRREY 90
            :|||:|:.:..:|....:.   .||..:      .|..:...|.....|.:::|.:|....|||.
  Fly     7 RLIELVRANPKLYERELRN---APYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRREL 68

  Fly    91 TNYLEEKVPPCWSYFDRMFFL----HPYLRKKHQQPKSLDTQVQDALAHLSNLSSRMQRERSVTI 151
            ...........||....:.||    ||.   .|:....|......:...:::....:|......:
  Fly    69 AKEKAGGTGSDWSLLPHLKFLQHHHHPI---NHRNSGDLSRSTLKSSDEVNDDEDPLQEAMDEQL 130

  Fly   152 PGSSSIGGQPTPSAHQSPPAQ---QLDNYLDYFDEAEH-------------------NNSELDDI 194
            ..:.:....||..||.:|.||   :::..|:...||..                   |:.::|||
  Fly   131 AVAGAAPAPPTNPAHATPVAQAEKRIEALLEGLGEANRIKAEKRILAYLCKCNLRALNDEQIDDI 195

  Fly   195 M 195
            :
  Fly   196 V 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 21/93 (23%)
BESS 431..465 CDD:281011
CG6683NP_648232.1 MADF 7..94 CDD:214738 19/89 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009996
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.