DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and CG9948

DIOPT Version :9

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster


Alignment Length:270 Identity:53/270 - (19%)
Similarity:93/270 - (34%) Gaps:88/270 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FKLIEIVQRDEAIYNPRHKYYFCRPYVENF---------WREVDLKLEKNPGASLAKWTNLRISF 86
            ||||::|:.:..:|.        |..:.|:         |..:...:..:....|.:|.||...|
  Fly    13 FKLIDLVEPNPVLYK--------RSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQF 69

  Fly    87 RREYTNYLEEKVPPCWSYFDRMFFLHPYLRKKHQQPKSLDTQVQDALAHLSNLSSRMQRERSVTI 151
            |:|:..  .:.....|.|.:|:.||     .:.|.|..:.|:.:             ..::..||
  Fly    70 RKEFRR--ADTSGSTWPYLERLRFL-----AEIQPPSKVKTKPK-------------TNKQEATI 114

  Fly   152 PGSSSIGGQPTPSAHQSPPAQQLDNYLDYFDEAEHNNSELDDIMEEEQQRNSRYHGQLDGNDIKS 216
                          ....|.|.|   .|.|::.:........|:||                   
  Fly   115 --------------QTETPVQFL---WDTFEDGDVPQQSSTFIIEE------------------- 143

  Fly   217 ECEEPVDDYEQEAHEPEEDEQDDQDLHKMAPTSS--------SSSAEAQRRYANQHSHASRMLPG 273
            ..|||.:...||  |...:||:..::  ::|.||        :...|.|||.|.:...|..:   
  Fly   144 VIEEPSEQIIQE--EIIYEEQEPAEI--ISPRSSFLQMDQILAQLKEPQRRRAERRITAFLL--- 201

  Fly   274 RLQMRTYHDE 283
            :.|:|...::
  Fly   202 KCQLRALSNQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 20/92 (22%)
BESS 431..465 CDD:281011
CG9948NP_001261492.1 MADF 14..95 CDD:214738 20/95 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009996
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.