DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and hng1

DIOPT Version :9

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:303 Identity:59/303 - (19%)
Similarity:115/303 - (37%) Gaps:69/303 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SASRWLTEEVFKLIEIVQRDEAIYNPRHKYYFCRPYVENFWREVDLKLEKNPGASLAKWTNLRIS 85
            |..|.|.:....||:.::...::|:|:...:......|..|.:|...|..:...:..:||.||..
  Fly     3 SNHRPLDDSDILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDR 67

  Fly    86 FRREYTNYLEEKVPPCW-----SYFDRMFFLHPYLRKKHQ-QPKSLDTQVQDALAHLSNLSSRMQ 144
            :.||..   ::::.|..     .:|.:|.||..::||:.: :.:..|.:.:..    ..:...:|
  Fly    68 YSRELK---QKRLHPSGEFGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPT----GWMKVDLQ 125

  Fly   145 RERSVTIPGSSSIGGQPTPSAHQSPPAQQLDNYLDYFDEAEHNNSELDDIMEEEQQRNSRYHGQL 209
            |.|...:|                         :|.....|...|...|  |.|:|.:  |..:|
  Fly   126 RRRRTRLP-------------------------IDTETLIEEQGSHAYD--EGEEQHD--YDAKL 161

  Fly   210 DGNDIKSECEEPVDDYEQEAHEPEEDEQDD-------------QDLHK--MAPTSSSSSAEAQRR 259
            :.:..:||....|.:.: :..|||::..|:             ..:|.  .||.::|:....:..
  Fly   162 ESHTTQSETYSVVVEAD-DGQEPEQESFDEFLGDAECEQKVKVVTIHPEIAAPNATSAPEPIESN 225

  Fly   260 YANQHSHASRMLPGRLQMRTYHDEMRGAIRPRSQELQAPTAAV 302
            :|:. ::...|.|...|.|.:          .:.||..|||.:
  Fly   226 HADL-NYLVCMPPNANQEREH----------SAPELPNPTAVI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 19/88 (22%)
BESS 431..465 CDD:281011
hng1NP_611558.2 MADF 15..98 CDD:214738 19/85 (22%)
BESS 264..298 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.