powered by:
Protein Alignment CG6276 and CG8119
DIOPT Version :9
Sequence 1: | NP_650445.3 |
Gene: | CG6276 / 41855 |
FlyBaseID: | FBgn0038316 |
Length: | 470 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_573050.1 |
Gene: | CG8119 / 32500 |
FlyBaseID: | FBgn0030664 |
Length: | 244 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 14/68 - (20%) |
Similarity: | 31/68 - (45%) |
Gaps: | 21/68 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 400 PPSALPLRLEANNASGGSVSNGGAELCDCKTDPDAMFLMSLLPDIQKLNGRDRGKIKIAFQNILQ 464
||||: ..:|| :.:..||:|::|.::.|:.|.:.:.:...:.:|:
Fly 190 PPSAM-----------AKISN----------ESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVLR 233
Fly 465 DYL 467
:.|
Fly 234 EML 236
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12243 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.