DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and CG8119

DIOPT Version :9

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster


Alignment Length:68 Identity:14/68 - (20%)
Similarity:31/68 - (45%) Gaps:21/68 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 PPSALPLRLEANNASGGSVSNGGAELCDCKTDPDAMFLMSLLPDIQKLNGRDRGKIKIAFQNILQ 464
            ||||:           ..:||          :.:..||:|::|.::.|:.|.:.:.:...:.:|:
  Fly   190 PPSAM-----------AKISN----------ESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVLR 233

  Fly   465 DYL 467
            :.|
  Fly   234 EML 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738
BESS 431..465 CDD:281011 7/33 (21%)
CG8119NP_573050.1 MADF 17..97 CDD:214738
BESS 201..234 CDD:281011 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.