DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and madf-10

DIOPT Version :9

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_492729.1 Gene:madf-10 / 190925 WormBaseID:WBGene00013717 Length:234 Species:Caenorhabditis elegans


Alignment Length:159 Identity:33/159 - (20%)
Similarity:62/159 - (38%) Gaps:48/159 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSNPNTSCSASRWLTEEVFKLIEIVQRDEAIYNPRHKYYFCRPYVENFWREVDLKLEKNPGASLA 77
            |:....|.:|.:.|..||   :|::.:...:..|.        .:|        ::||:      
 Worm    66 STREKVSSAARKNLFAEV---VEVINQQFVLSPPL--------TIE--------EIEKH------ 105

  Fly    78 KWTNLR---ISFRREYTNYLEEKVP--PCWSYFDRMFFL-----HPYLRKKHQQPKSLDTQVQDA 132
             |.||:   :..||:.| :..:..|  |.|.:||.:.||     :.::.||  :|.....|..|.
 Worm   106 -WKNLKDTYVKTRRKLT-FDHDGCPIRPKWKFFDSLMFLDSVNQNDFVMKK--RPMQFQGQPYDL 166

  Fly   133 LAHLSNLSSRMQRE---------RSVTIP 152
            ....|:...:::..         ||:.:|
 Worm   167 YQGPSSKKEKLEEMPSDEYMEFCRSLYLP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 18/93 (19%)
BESS 431..465 CDD:281011
madf-10NP_492729.1 MADF 53..147 CDD:214738 24/107 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.