DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6276 and madf-3

DIOPT Version :9

Sequence 1:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 / 186755 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans


Alignment Length:281 Identity:55/281 - (19%)
Similarity:95/281 - (33%) Gaps:87/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LTEEVF--KLIEIVQRDEAIYNPRHKYYFCRPYVENFWREV--DLKLEKNPGASLAKWTNLRISF 86
            :.|..|  :|||.|:....:::...:.|....|....|:.:  .|..:.:|....|:|..||..:
 Worm     1 MIEPTFNLRLIEAVRHSRCLFDNTDRQYRNTEYKNRVWQRLVTVLGFDGDPRMLSARWKQLRDKY 65

  Fly    87 RRE--YTNYLEEKVPPCWSYFDRMFFLHPYL--RKKHQQPKSLDTQVQDALAHL---SNLSSRMQ 144
            .:|  ...|..||  ..|.||..:.||.|::  |.:....:...|.|.:.:|..   .||...::
 Worm    66 GKEKRKQKYGNEK--SSWQYFKHLHFLDPHMTDRAEISPSRKEPTGVHEKIAEPCFGKNLILEVR 128

  Fly   145 RE-------------------------RSVTIPGSSSIGGQPTPSAHQ----------------- 167
            |.                         ..:..||:       .||.::                 
 Worm   129 RHPCLYDVRDPKYRHGDCRTQAWGMIIDKLRYPGT-------VPSIYKQWKKHRDRYVREKRRLR 186

  Fly   168 ---SPPAQQLDNYLDYFDEAEHNNSELDDIMEEEQ----QRNSRYHGQLDGNDIKSECEEPVDDY 225
               .|..|.:..:..|.|.|     .:|..::|:|    .|:.:..|..||.:     ::.:.||
 Worm   187 NLGDPNVQDVSTWEMYDDMA-----WIDQHLDEQQLSRCARSLKRGGNNDGGN-----QDEMSDY 241

  Fly   226 EQEAHEPEEDEQDDQDLHKMA 246
                    .|..||.:...||
 Worm   242 --------GDYDDDINYVMMA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6276NP_650445.3 MADF 32..116 CDD:214738 23/89 (26%)
BESS 431..465 CDD:281011
madf-3NP_494766.1 MADF 9..94 CDD:214738 23/86 (27%)
MADF 122..212 CDD:214738 13/101 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.