DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and EDE1

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_009506.1 Gene:EDE1 / 852233 SGDID:S000000143 Length:1381 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:47/214 - (21%)
Similarity:96/214 - (44%) Gaps:23/214 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AKEQLEKANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSADENN 124
            |..||..|.||:......:.:...:.:..|.|..:..::|::..|...:.|.||.....:.|:|.
Yeast   595 ASAQLSNATTEMANLSNQVNSLSKQASITNDKKSRATQELKRVTEMKNSIQIKLNNLRSTHDQNV 659

  Fly   125 RMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESK 189
            :..:.||.:..|..:..:.|..||..:......|::|.:|::..|              :..::|
Yeast   660 KQTEQLEAQVLQVNKENETLAQQLAVSEANYHAAESKLNELTTDL--------------QESQTK 710

  Fly   190 IMELEEELKVVGNSLKSLEVS-EEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVKRLQKEV 253
            ..||:|::    .:|.|:..| :.:.|::.::.|:|...:.:..|:.|..    :..|..||||:
Yeast   711 NAELKEQI----TNLNSMTASLQSQLNEKQQQVKQERSMVDVNSKQLELN----QVTVANLQKEI 767

  Fly   254 DRLEDELGINKDRYKSLAD 272
            |.|.:::.:...:.|.|.|
Yeast   768 DGLGEKISVYLTKQKELND 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 47/214 (22%)
EDE1NP_009506.1 EH 9..101 CDD:197477
EH 128..221 CDD:197477
EH 270..363 CDD:197477
Atrophin-1 <355..>528 CDD:397323
Smc <595..877 CDD:224117 47/214 (22%)
PRK08581 903..>1111 CDD:236304
UBA_scEDE1_like 1345..1379 CDD:270471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.