DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and PMD2

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_172140.1 Gene:PMD2 / 837164 AraportID:AT1G06530 Length:323 Species:Arabidopsis thaliana


Alignment Length:271 Identity:66/271 - (24%)
Similarity:124/271 - (45%) Gaps:66/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTAKEQLEKANTELEEKEKLLTATESEVATQNR 90
            :.|..|..|  .:||:::.|||.:..::..|......::|....|:||    |...||:.   .|
plant    23 DQQGDDGKS--TELNQKIGDLESQNQELARDNDAINRKIESLTAEIEE----LRGAESKA---KR 78

  Fly    91 KVQQIEEDLEKSEERSTTAQQKLLEATQSADENNRMCKVLENRSQQDEERMDQLTNQLKEARMLA 155
            |:.::|.:::||:|     ::|:|||             :.:|:.:.|..:.:|.::|..||...
plant    79 KMGEMEREIDKSDE-----ERKVLEA-------------IASRASELETEVARLQHELITARTEG 125

  Fly   156 EDADTKSD----EVSRKLAFVED-ELEVA---------EDRVRSGESK-----IMELEE------ 195
            |:|..:::    |:|:|...:|: |.|||         |.|::..|||     :.||:|      
plant   126 EEATAEAEKLRSEISQKGGGIEELEKEVAGLRTVKEENEKRMKELESKLGALEVKELDEKNKKFR 190

  Fly   196 --------------ELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQV 246
                          |:..:...:||||....|....::::..|...:...||::|::....|.::
plant   191 AEEEMREKIDNKEKEVHDLKEKIKSLESDVAKGKTELQKWITEKMVVEDSLKDSEKKVVALESEI 255

  Fly   247 KRLQKEVDRLE 257
            ..|||::|..|
plant   256 VELQKQLDDAE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 58/249 (23%)
PMD2NP_172140.1 SMC_prok_A 32..>277 CDD:274009 63/260 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.