DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and AT2G36410

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_565846.1 Gene:AT2G36410 / 818215 AraportID:AT2G36410 Length:195 Species:Arabidopsis thaliana


Alignment Length:164 Identity:40/164 - (24%)
Similarity:75/164 - (45%) Gaps:29/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 QSADENNRMCKVL--------ENRSQQDEE-----------RMDQLTNQLKEARMLAEDADTKSD 163
            |...::|.|  ||        .:.|::|||           :.|::..:..|.|...:....:.:
plant    32 QPQQQSNEM--VLHTGSLSFSSHMSREDEEMTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVE 94

  Fly   164 EVSRKLAFVEDELEVAEDRVRSGES----KIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKRE 224
            :.:::|:.:.:|||...|.:|...|    ||..:.:|||.:|::::..|...::|.....|..||
plant    95 QETKRLSTIREELESMADPMRKEVSVVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNRE 159

  Fly   225 MKTLSIKLKEAEQRAEHAEK----QVKRLQKEVD 254
            ...|..||.|.||....:||    :::.|.|.::
plant   160 KVQLITKLMEMEQLVGESEKLRMIKLEELSKSIE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 40/164 (24%)
AT2G36410NP_565846.1 Transcrip_act 41..194 CDD:398553 37/153 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.