DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and AT2G27740

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_180342.1 Gene:AT2G27740 / 817320 AraportID:AT2G27740 Length:174 Species:Arabidopsis thaliana


Alignment Length:182 Identity:43/182 - (23%)
Similarity:82/182 - (45%) Gaps:20/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ATESEVATQNRK--VQQIEEDLEKSEERSTTAQQKLLEATQSADENNRMCKVLENRSQQDEERMD 142
            ||..::..|.:.  :|:|:.....|...|....:|..|.:|||      ..:.:.:..:.|.|..
plant     2 ATTRQILEQPQSPFIQRIKSSGNISMNGSPMIDEKEEELSQSA------FALFKAKEDEIERRKM 60

  Fly   143 QLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIME----LEEELKVVGNS 203
            ::.:::::...|||:|       :|:||.:.:|||...|.:|...|.|.:    :..|||.:|.|
plant    61 EVKDRVQKKLGLAEEA-------TRRLAEIREELEALTDPMRKEISAIRKRVDAINRELKPLGQS 118

  Fly   204 LKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAE-KQVKRLQKEVD 254
            .:..|...::|.:...|..:|......||.|....:|... .:::.|.|.::
plant   119 CQRKEREFKEALEAYNEKNKEKAIFVSKLVELVTESEKLRMTKLEELSKSIE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 43/182 (24%)
AT2G27740NP_180342.1 Transcrip_act 19..170 CDD:282763 39/163 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.